Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human BPIFA2 (BPI fold containing family A member 2) Expressed in vitro E.coli expression system, Full Length of Mature Protein (CAT#: MPX0977K)

This product is a Human BPIFA2 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • BPIFA2
  • Protein Length
  • Full Length of Mature Protein
  • Protein Class
  • Receptor
  • Molecular Weight
  • 25.1kDa
  • Sequence
  • ESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSSLLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • Tag free
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • BPIFA2
  • Full Name
  • BPI fold containing family A member 2
  • Introduction
  • This gene encodes a member of the palate, lung and nasal epithelium clone (Plunc) family of proteins. Members of this family have been proposed to play a role in the local antibacterial response in nose, mouth and upper respiratory pathways. The encoded soluble salivary protein binds bacterial lipopolysaccharide (LPS) and inhibits bacterial growth. This gene is present in a gene cluster on chromosome 20. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • BPIFA2; PSP; SPLUNC2; C20orf70; bA49G10.1; parotid secretory protein; short palate, lung and nasal epithelium carcinoma-associated protein 2; BPI fold containing family A member 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us