Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human BTN3A2 (Butyrophilin subfamily 3 member A2) Expressed in Yeast with 6xHis tag at the N-terminus for Antibody Discovery, Partial (30-248aa) (CAT#: MPX4322K)

This product is a 25.6kDa Human BTN3A2 membrane protein expressed in Yeast. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • BTN3A2
  • Protein Length
  • Partial (30-248aa)
  • Protein Class
  • Immunity
  • Molecular Weight
  • 25.6kDa
  • TMD
  • 1
  • Sequence
  • QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPW

Product Description

  • Expression Systems
  • Yeast
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • BTN3A2
  • Full Name
  • Butyrophilin subfamily 3 member A2
  • Introduction
  • This gene encodes a member of the immunoglobulin superfamily, which resides in the juxta-telomeric region of the major histocompatability class 1 locus and is clustered with the other family members on chromosome 6. The encoded protein may be involved in the adaptive immune response. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • BTN3A2; BTF4; BT3.2; CD277; BTN3.2; butyrophilin protein; Butyrophilin subfamily 3 member A2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us