Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CCR1 (C-C motif chemokine receptor 1) Full Length (CAT#: MPC0048K) Made to Order

This product is a 41.1 kDa Human CCR1 membrane protein expressed in Baculovirus/Insect expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CCR1
  • Protein Length
  • Full length
  • Protein Class
  • GPCR
  • Molecular Weight
  • 41.1 kDa
  • TMD
  • 7
  • Sequence
  • METPNTTEDYDTTTEFDYGDATPCQKVNERAFGAQLLPPLYSLVFVIGLV
    GNILVVLVLVQYKRLKNMTSIYLLNLAISDLLFLFTLPFWIDYKLKDDWV
    FGDAMCKILSGFYYTGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFG
    VITSIIIWALAILASMPGLYFSKTQWEFTHHTCSLHFPHESLREWKLFQA
    LKLNLFGLVLPLLVMIICYTGIIKILLRRPNEKKSKAVRLIFVIMIIFFL
    FWTPYNLTILISVFQDFLFTHECEQSRHLDLAVQVTEVIAYTHCCVNPVI
    YAFVGERFRKYLRQLFHRRVAVHLVKWLPFLSVDRLERVSSTSPSTGEHE
    LSAGF

Product Description

  • Expression Systems
  • Baculovirus/Insect expression system
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • CCR1
  • Full Name
  • C-C motif chemokine receptor 1
  • Introduction
  • This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. The ligands of this receptor include macrophage inflammatory protein 1 alpha (MIP-1 alpha), regulated on activation normal T expressed and secreted protein (RANTES), monocyte chemoattractant protein 3 (MCP-3), and myeloid progenitor inhibitory factor-1 (MPIF-1). Chemokines and their receptors mediated signal transduction are critical for the recruitment of effector immune cells to the site of inflammation. Knockout studies of the mouse homolog suggested the roles of this gene in host protection from inflammatory response, and susceptibility to virus and parasite. This gene and other chemokine receptor genes, including CCR2, CCRL2, CCR3, CCR5 and CCXCR1, are found to form a gene cluster on chromosome 3p.
  • Alternative Names
  • CKR1; CD191; CKR-1; HM145; CMKBR1; MIP1aR; SCYAR1; C-C CKR-1; CC-CKR-1; CCR-1; LD78 receptor; MIP-1alpha-R; RANTES receptor; RANTES-R; chemokine (C-C motif) receptor 1; macrophage inflammatory protein 1-alpha receptor; CCR1; C-C motif chemokine receptor 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us