Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CD244 (CD244 molecule) Expressed in NS0 for Antibody Discovery, Partial (22-221aa) (CAT#: MPX0557K)

This product is a 48.8 kDa Human CD244 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD244
  • Protein Length
  • Partial (22-221aa)
  • Protein Class
  • Receptor; Immunity
  • Molecular Weight
  • 48.8 kDa
  • TMD
  • 1
  • Sequence
  • CQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQ
    NGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTAT
    FQVFVFDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYL
    DEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEFR

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.01 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • CD244
  • Full Name
  • CD244 molecule
  • Introduction
  • This gene encodes a cell surface receptor expressed on natural killer (NK) cells (and some T cells) that mediate non-major histocompatibility complex (MHC) restricted killing. The interaction between NK-cell and target cells via this receptor is thought to modulate NK-cell cytolytic activity. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • CD244; 2B4; NAIL; Nmrk; NKR2B4; SLAMF4; natural killer cell receptor 2B4; CD244 molecule, natural killer cell receptor 2B4; NK cell activation inducing ligand NAIL; NK cell activation-inducing ligand; NK cell type I receptor protein 2B4; SLAM family member 4; h2B4; signaling lymphocytic activation molecule 4; CD244 molecule

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us