Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CD79A (CD79a molecule) Expressed in NS0 for Antibody Discovery, Partial (33-143aa) (CAT#: MPX0161K)

This product is a 13 kDa Human CD79A membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD79A
  • Protein Length
  • Partial (33-143aa)
  • Protein Class
  • Immunity
  • Molecular Weight
  • 13 kDa
  • TMD
  • 1
  • Sequence
  • LWMHKVPASLMVSLGEDA
    HFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSH
    GGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNR

Product Description

  • Expression Systems
  • NS0
  • Tag
  • 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 250 μg/mL in PBS.
  • Endotoxin
  • <1.0 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS and EDTA.

Target

  • Target Protein
  • CD79A
  • Full Name
  • CD79a molecule
  • Introduction
  • The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-alpha protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described.
  • Alternative Names
  • CD79A; IGA; MB-1; B-cell antigen receptor complex-associated protein alpha chain; CD79a antigen (immunoglobulin-associated alpha); CD79a molecule, immunoglobulin-associated alpha; MB-1 membrane glycoprotein; ig-alpha; membrane-bound immunoglobulin-associated protein; surface IgM-associated protein; CD79a molecule

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us