Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CD82 (CD82 molecule) Full Length (CAT#: MPC1829K) Made to Order

This product is a 29.6 kDa Human CD82 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD82
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 29.6 kDa
  • TMD
  • 4
  • Sequence
  • MGSACIKVTKYFLFLFNLIFFILGAVILGFGVWILADKSSFISVLQTSSS
    SLRMGAYVFIGVGAVTMLMGFLGCIGAVNEVRCLLGLYFAFLLLILIAQV
    TAGALFYFNMGKLKQEMGGIVTELIRDYNSSREDSLQDAWDYVQAQVKCC
    GWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRT
    QSGNHPEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAIIELLGMVLSI
    CLCRHVHSEDYSKVPKY

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • CD82
  • Full Name
  • CD82 molecule
  • Introduction
  • This metastasis suppressor gene product is a membrane glycoprotein that is a member of the transmembrane 4 superfamily. Expression of this gene has been shown to be downregulated in tumor progression of human cancers and can be activated by p53 through a consensus binding sequence in the promoter. Its expression and that of p53 are strongly correlated, and the loss of expression of these two proteins is associated with poor survival for prostate cancer patients. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
  • Alternative Names
  • CD82; R2; 4F9; C33; IA4; ST6; GR15; KAI1; SAR2; TSPAN27; CD82 antigen; C33 antigen; inducible membrane protein R2; kangai 1 (suppression of tumorigenicity 6, prostate; CD82 antigen (R2 leukocyte antigen, antigen detected by monoclonal and antibody IA4)); metastasis suppressor Kangai-1; tetraspanin-27; tspan-27; CD82 molecule

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us