Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CHRFAM7A (CHRNA7 (exons 5-10) and FAM7A (exons A-E) fusion) Full Length (CAT#: MPC2120K) Made to Order

This product is a 46.2 kDa Human CHRFAM7A membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CHRFAM7A
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 46.2 kDa
  • TMD
  • 5
  • Sequence
  • MQKYCIYQHFQFQLLIQHLWIAANCDIADERFDATFHTNVLVNSSGHCQY
    LPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQEADISGY
    IPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIP
    CVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSV
    PLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCA
    WFLRMKRPGEDKVRPACQHKQRRCSLASVEMSAVAPPPASNGNLLYIGFR
    GLDGVHCVPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEV
    RYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSA
    PNFVEAVSKDFA

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • CHRFAM7A
  • Full Name
  • CHRNA7 (exons 5-10) and FAM7A (exons A-E) fusion
  • Introduction
  • The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The family member CHRNA7, which is located on chromosome 15 in a region associated with several neuropsychiatric disorders, is partially duplicated and forms a hybrid with a novel gene from the family with sequence similarity 7 (FAM7A). Alternative splicing has been observed, and two variants exist, for this hybrid gene. The N-terminally truncated products predicted by the largest open reading frames for each variant would lack the majority of the neurotransmitter-gated ion-channel ligand binding domain but retain the transmembrane region that forms the ion channel. Although current evidence supports transcription of this hybrid gene, translation of the nicotinic acetylcholine receptor-like protein-encoding open reading frames has not been confirmed.
  • Alternative Names
  • CHRFAM7A; D-10; CHRNA7; NACHRA7; CHRNA7-DR1; CHRNA7-FAM7A fusion protein; CHRNA7 (cholinergic receptor, nicotinic, alpha 7, exons 5-10) and FAM7A (family with sequence similarity 7A, exons A-E) fusion; CHRNA7 (cholinergic receptor, nicotinic, alpha polypeptide 7, exons 5-10) and FAM7A (family with sequence similarity 7A, exons A-E) fusion; Neuronal acetylcholine receptor subunit alpha-7; alpha 7 neuronal nicotinic acetylcholine receptor-FAM7A hybrid; alpha-7 nicotinic cholinergic receptor subunit; CHRNA7 (exons 5-10) and FAM7A (exons A-E) fusion

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us