Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CLEC10A (C-type lectin domain containing 10A) Expressed in NS0 for Antibody Discovery, Partial (61-316aa) (CAT#: MPX0518K)

This product is a 29.6 kDa Human CLEC10A membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CLEC10A
  • Protein Length
  • Partial (61-316aa)
  • Protein Class
  • Immunity
  • Molecular Weight
  • 29.6 kDa
  • TMD
  • 1
  • Sequence
  • QNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEET
    IASLKAEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPSVCVPVHSEML
    LRVQQLVQDLKKLTCQVATLNNNASTEGTCCPVNWVEHQDSCYWFSHSGM
    SWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKW
    VDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPY
    HWVCEAGLGQTSQESH

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 200 μg/mL in sterile PBS.
  • Endotoxin
  • <0.01 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • CLEC10A
  • Full Name
  • C-type lectin domain containing 10A
  • Introduction
  • This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may function as a cell surface antigen. Two transcript variants encoding distinct isoforms have been identified for this gene.
  • Alternative Names
  • CLEC10A; HML; MGL; HML2; CD301; CLECSF13; CLECSF14; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 13 (macrophage-derived); C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 14 (macrophage-derived); macrophage lectin 2 (calcium dependent); C-type lectin domain containing 10A

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us