Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human VTCN1 (V-set domain containing T cell activation inhibitor 1) Expressed in NS0 for Antibody Discovery, Partial (29-258aa) (CAT#: MPX0643K)

This product is a 26.7 kDa Human VTCN1 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • VTCN1
  • Protein Length
  • Partial (29-258aa)
  • Protein Class
  • Immunity
  • Molecular Weight
  • 26.7 kDa
  • TMD
  • 1
  • Sequence
  • FGISGRHSITVTTVASAGNIGE
    DGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGR
    TAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAF
    SMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFE
    LNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSH
    LQLLNSKA

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • 10xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in PBS.
  • Endotoxin
  • <1.0 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • VTCN1
  • Full Name
  • V-set domain containing T cell activation inhibitor 1
  • Introduction
  • This gene encodes a protein belonging to the B7 costimulatory protein family. Proteins in this family are present on the surface of antigen-presenting cells and interact with ligand bound to receptors on the surface of T cells. Studies have shown that high levels of the encoded protein has been correlated with tumor progression. A pseudogene of this gene is located on chromosome 20. Multiple transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • VTCN1; B7X; B7H4; B7S1; B7-H4; B7h.5; VCTN1; PRO1291; V-set domain-containing T-cell activation inhibitor 1; B7 family member, H4; B7 homolog 4; B7 superfamily member 1; T cell costimulatory molecule B7x; immune costimulatory protein B7-H4; V-set domain containing T cell activation inhibitor 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us