Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CLEC6A (C-type lectin domain containing 6A) Expressed in NS0 for Antibody Discovery, Partial (46-209aa) (CAT#: MPX0442K)

This product is a 19.7 kDa Human CLEC6A membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CLEC6A
  • Protein Length
  • Partial (46-209aa)
  • Protein Class
  • Immunity
  • Molecular Weight
  • 19.7 kDa
  • TMD
  • 1
  • Sequence
  • TYGET
    GKRLSELHSYHSSLTCFSEGTKVPAWGCCPASWKSFGSSCYFISSEEKVW
    SKSEQNCVEMGAHLVVFNTEAEQNFIVQQLNESFSYFLGLSDPQGNNNWQ
    WIDKTPYEKNVRFWHLGEPNHSAEQCASIVFWKPTGWGWNDVICETRRNS
    ICEMNKIYL

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.01 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >90%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • CLEC6A
  • Full Name
  • C-type lectin domain containing 6A
  • Introduction
  • The protein encoded by this gene is a type II membrane receptor with an extracellular C-type lectin-like domain fold. The extracellular portion binds structures with a high mannose content and has been shown to recognize several pathogens, including C. elegans, S. cerevisiae, M. tuberculosis, C. neoformans, and house dust mite. When stimulated, the encoded protein initiates signalling through the CARD9-Bcl10-Malt1 pathway, leading to the induction of cytokines. Two transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • CLEC6A; CLEC4N; CLECSF10; dectin-2; hDECTIN-2; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 10; C-type lectin superfamily member 10; DC-associated C-type lectin 2; dectin 2; dendritic cell-associated C-type lectin 2; C-type lectin domain containing 6A

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us