Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CLEC9A (C-type lectin domain containing 9A) Expressed in NS0 for Antibody Discovery, Partial (57-241aa) (CAT#: MPX0696K)

This product is a 47.8 kDa Human CLEC9A membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CLEC9A
  • Protein Length
  • Partial (57-241aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 47.8 kDa
  • TMD
  • 1
  • Sequence
  • KLLQVSTIAMQQQEKLIQQERALLNFTEWKRSCALQMKYCQAFM
    QNSLSSAHNSSPCPNNWIQNRESCYYVSEIWSIWHTSQENCLKEGSTLLQ
    IESKEEMDFITGSLRKIKGSYDYWVGLSQDGHSGRWLWQDGSSPSPGLLP
    AERSQSANQVCGYVKSNSLLSSNCSTWKYFICEKYALRSSV

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc tag at the N-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 200 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE under reducing conditions and visualized by silver stain.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • CLEC9A
  • Full Name
  • C-type lectin domain containing 9A
  • Introduction
  • CLEC9A is a group V C-type lectin-like receptor (CTLR) that functions as an activation receptor and is expressed on myeloid lineage cells.
  • Alternative Names
  • CLEC9A; CD370; DNGR1; DNGR-1; UNQ9341; HEEE9341; C-type lectin domain containing 9A

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us