Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CLIC1 (Chloride intracellular channel 1) Full Length (CAT#: MPC0492K) Made to Order

This product is a 26.9 kDa Human CLIC1 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CLIC1
  • Protein Length
  • Full length
  • Protein Class
  • Transporter; Ion channel
  • Molecular Weight
  • 26.9 kDa
  • TMD
  • 1
  • Sequence
  • MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKR
    RTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALN
    PESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPE
    EVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIP
    EAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • CLIC1
  • Full Name
  • Chloride intracellular channel 1
  • Introduction
  • Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 1 is a member of the p64 family; the protein localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity.
  • Alternative Names
  • G6; CL1C1; NCC27; CLCNL1; chloride intracellular channel protein 1; RNCC protein; chloride channel ABP; hRNCC; nuclear chloride ion channel 27; nuclear chloride ion channel protein; p64CLCP; regulatory nuclear chloride ion channel protein; CLIC1; Chloride intracellular channel 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us