Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SMDT1 (Single-pass membrane protein with aspartate rich tail 1) Expressed in vitro E.coli expression system, Full Length of Mature Protein (CAT#: MPX0989K)

This product is a Human SMDT1 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SMDT1
  • Protein Length
  • Full Length of Mature Protein
  • Protein Class
  • Transport
  • TMD
  • 1
  • Sequence
  • VIVTRSGAILPKPVKMSFGLLRVFSIVIPFLYVGTLISKNFAALLEEHDIFVPEDDDDDD

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • SMDT1
  • Full Name
  • Single-pass membrane protein with aspartate rich tail 1
  • Introduction
  • This gene encodes a core regulatory component of a calcium channel in the mitochondrial inner membrane.
  • Alternative Names
  • SMDT1; DDDD; EMRE; C22orf32; essential MCU regulator, mitochondrial; UPF0466 protein C22orf32, mitochondrial; single-pass membrane protein with aspartate-rich tail 1, mitochondrial; Single-pass membrane protein with aspartate rich tail 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us