Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CLIC3 (Chloride intracellular channel 3) Full Length (CAT#: MPC2187K) Made to Order

This product is a 26.6 kDa Human CLIC3 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CLIC3
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 26.6 kDa
  • TMD
  • 1
  • Sequence
  • MAETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSP
    DVLKDFAPGSQLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRE
    SNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRALARLDSYLRAPLEHEL
    AGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELR
    GVRRYLDSAMQEKEFKYTCPHSAEILAAYRPAVHPR

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Based on specific requirements

Target

  • Target Protein
  • CLIC3
  • Full Name
  • Chloride intracellular channel 3
  • Introduction
  • Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 3 is a member of the p64 family and is predominantly localized in the nucleus and stimulates chloride ion channel activity. In addition, this protein may participate in cellular growth control, based on its association with ERK7, a member of the MAP kinase family.
  • Alternative Names
  • CLIC3; Chloride intracellular channel 3

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us