Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CMTM5 (CKLF like MARVEL transmembrane domain containing 5) Full Length (CAT#: MPC1245K) Made to Order

This product is a 24.6 kDa Human CMTM5 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CMTM5
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 24.6 kDa
  • TMD
  • 4
  • Sequence
  • MLSARDRRDRHPEEGVVAELQGFAVDKAFLTSHKGILLETELALTLIIFI
    CFTASISAYMAAALLEFFITLAFLFLYATQYYQRFDRINWPCLLQGHGQS
    GGPHPLDLLSHSAKVQPQPWPGLTPPGWHTPAAVPWVPAPAPGFWSWLLW
    FICFHSLGSSDFLRCVSAIIIFLVVSFAAVTSRDGAAIAAFVFGIILVSI
    FAYDAFKIYRTEMAPGASQGDQQ

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • CMTM5
  • Full Name
  • CKLF like MARVEL transmembrane domain containing 5
  • Introduction
  • This gene encodes a member of the chemokine-like factor superfamily. This family of genes encodes multi-pass membrane proteins that are similar to both the chemokine and the transmembrane 4 superfamilies of signaling molecules. The encoded protein may exhibit tumor suppressor activity. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • CMTM5; CKLFSF5; CKLF-like MARVEL transmembrane domain-containing protein 5; chemokine-like factor super family 5; chemokine-like factor superfamily member 5; CKLF like MARVEL transmembrane domain containing 5

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us