Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CNEP1R1 (CTD nuclear envelope phosphatase 1 regulatory subunit 1) Full Length (CAT#: MPC1991K) Made to Order

This product is a 14.2 kDa Human CNEP1R1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CNEP1R1
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 14.2 kDa
  • TMD
  • 2
  • Sequence
  • MNSLEQAEDLKAFERRLTEYIHCLQPATGRWRMLLIVVSVCTATGAWNWL
    IDPETQKVSFFTSLWNHPFFTISCITLIGLFFAGIHKRVVAPSIIAARCR
    TVLAEYNMSCDDTGKLILKPRPHVQ

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • CNEP1R1
  • Full Name
  • CTD nuclear envelope phosphatase 1 regulatory subunit 1
  • Introduction
  • This gene encodes a transmembrane protein that belongs to the Tmemb_18A family. A similar protein in yeast is a component of an endoplasmic reticulum-associated protein phosphatase complex and is thought to play a role in the synthesis of triacylglycerol. Alternate splicing results in multiple transcript variants.
  • Alternative Names
  • CNEP1R1; NEP1R1; TMP125; NEP1-R1; TMEM188; C16orf69; nuclear envelope phosphatase-regulatory subunit 1; nuclear envelope phosphatase 1-regulatory subunit 1; transmembrane protein 188; CTD nuclear envelope phosphatase 1 regulatory subunit 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us