Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human KREMEN1 (Kringle containing transmembrane protein 1) Expressed in HEK293 for Antibody Discovery, Partial (1-394aa) (CAT#: MPX0147K)

This product is a 42.6 kDa Human KREMEN1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • KREMEN1
  • Protein Length
  • Partial (1-394aa)
  • Protein Class
  • Transporter
  • Molecular Weight
  • 42.6 kDa
  • TMD
  • 1
  • Sequence
  • MAPPAARLALLSAAALTLAARPAPSPGLGPGPECFTANGADYRGTQNWTALQGGKPCLFWNETFQHPYNTLKYPNGEGGLGEHNYCRNPDGDVSPWCYVAEHEDGVYWKYCEIPACQMPGNLGCYKDHGNPPPLTGTSKTSNKLTIQTCISFCRSQRFKFAGMESGYACFCGNNPDYWKYGEAASTECNSVCFGDHTQPCGGDGRIILFDTLVGACGGNYSAMSSVVYSPDFPDTYATGRVCYWTIRVPGASHIHFSFPLFDIRDSADMVELLDGYTHRVLARFHGRSRPPLSFNVSLDFVILYFFSDRINQAQGFAVLYQAVKEELPQERPAVNQTVAEVITEQANLSVSAARSSKVLYVITTSPSHPPQTVPGSNSWAPPMGAGSHRVEGWT

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • His tag at the C-terminus
  • Protein Format
  • Soluble
  • Endotoxin
  • < 1.0 EU per 1 μg
  • Purity
  • > 95 % SDS-PAGE.
  • Buffer
  • pH: 7.4, Constituent: 100% PBS

Target

  • Target Protein
  • KREMEN1
  • Full Name
  • Kringle containing transmembrane protein 1
  • Introduction
  • This gene encodes a high-affinity dickkopf homolog 1 (DKK1) transmembrane receptor that functionally cooperates with DKK1 to block wingless (WNT)/beta-catenin signaling. The encoded protein is a component of a membrane complex that modulates canonical WNT signaling through lipoprotein receptor-related protein 6 (LRP6). It contains extracellular kringle, WSC, and CUB domains. Alternatively spliced transcript variants encoding distinct isoforms have been observed for this gene.
  • Alternative Names
  • KREMEN1; KRM1; ECTD13; KREMEN; kremen protein 1; dickkopf receptor; kringle domain-containing transmembrane protein 1; kringle-coding gene marking the eye and the nose; kringle-containing protein marking the eye and the nose; Kringle containing transmembrane protein 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us