Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CXCL10 (C-X-C motif chemokine ligand 10) expressed in E. coli for Antibody Discovery (CAT#: MP1277J)

This product is a 8.6 kDa Human CXCL10 membrane protein expressed in E. coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CXCL10
  • Protein Length
  • Full-length
  • Protein Class
  • Druggable Genome, Secreted Protein, Transmembrane
  • Molecular Weight
  • 8.6 kDa
  • Sequence
  • VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

Product Description

  • Expression Systems
  • E. coli
  • Tag
  • Tag Free
  • Endotoxin
  • < 1 EU/µg
  • Purity
  • > 95% as determined by SDS-PAGE and Coomassie blue staining
  • Buffer
  • 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.2

Target

  • Target Protein
  • CXCL10
  • Full Name
  • C-X-C motif chemokine ligand 10
  • Introduction
  • This antimicrobial gene encodes a chemokine of the CXC subfamily and ligand for the receptor CXCR3. Binding of this protein to CXCR3 results in pleiotropic effects, including stimulation of monocytes, natural killer and T-cell migration, and modulation of adhesion molecule expression. This gene may also be a key regulator of the 'cytokine storm' immune response to SARS-CoV-2 infection.
  • Alternative Names
  • C7; IFI10; INP10; IP-10; crg-2; mob-1; SCYB10; gIP-10

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us