Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CXCR1 (C-X-C motif chemokine receptor 1) for Antibody Discovery (CAT#: MP1343J)

This product is a 39.8 kDa Human CXCR1 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CXCR1
  • Protein Length
  • Full-length
  • Protein Class
  • GPCR
  • Molecular Weight
  • 39.8 kDa
  • TMD
  • 7
  • Sequence
  • MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNKYVVIIAYALVFLLSLLGNSLV MLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVN FYSGILLLACISVDRYLAIVHATRTLTQKRHLVKFVCLGCWGLSMNLSLPFFLFRQAYHP NNSSPVCYEVLGNDTAKWRMVLRILPHTFGFIVPLFVMLFCYGFTLRTLFKAHMGQKHRA MRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQESCERRNNIGRALDATEILGFLHSCL NPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHRVTSYTSSSVNVSSNL

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • N-His or Tag-Free
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • CXCR1
  • Full Name
  • C-X-C motif chemokine receptor 1
  • Introduction
  • The protein encoded by this gene is a member of the G-protein-coupled receptor family. This protein is a receptor for interleukin 8 (IL8). It binds to IL8 with high affinity, and transduces the signal through a G-protein activated second messenger system. Knockout studies in mice suggested that this protein inhibits embryonic oligodendrocyte precursor migration in developing spinal cord. This gene, IL8RB, a gene encoding another high affinity IL8 receptor, as well as IL8RBP, a pseudogene of IL8RB, form a gene cluster in a region mapped to chromosome 2q33-q36.
  • Alternative Names
  • C C; C C CKR 1; C-X-C chemokine receptor type 1; CCCKR1; CD 181; CD128; CD181; CD181 antigen; CDw128a; Chemokine (C X C motif) receptor 1; Chemokine (C X C) receptor 1; Chemokine receptor 1; CKR 1; CMKAR1; CXC-R1; CXCR 1; CXCR-1; CXCR1; CXCR1_HUMAN; High affinity interleukin 8 receptor A; High affinity interleukin-8 receptor A; IL 8 receptor type 1; IL 8R A; IL-8 receptor type 1; IL-8R A; IL8 receptor; IL8 receptor type 1; IL8R1; IL8RA; IL8RBA; Interleukin 8 receptor alpha; Interleukin 8 receptor type 1; Interleukin 8 receptor type A

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us