Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CXCR1 (C-X-C motif chemokine receptor 1) Full Length (CAT#: MPC0071K) Made to Order

This product is a 39.7 kDa Human CXCR1 membrane protein expressed in Baculovirus/Insect expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CXCR1
  • Protein Length
  • Full length
  • Protein Class
  • GPCR
  • Molecular Weight
  • 39.7 kDa
  • TMD
  • 7
  • Sequence
  • MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNKYVVIIAYALVF
    LLSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKV
    NGWIFGTFLCKVVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKR
    HLVKFVCLGCWGLSMNLSLPFFLFRQAYHPNNSSPVCYEVLGNDTAKWRM
    VLRILPHTFGFIVPLFVMLFCYGFTLRTLFKAHMGQKHRAMRVIFAVVLI
    FLLCWLPYNLVLLADTLMRTQVIQESCERRNNIGRALDATEILGFLHSCL
    NPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHRVTSYTSSSVNVSSNL

Product Description

  • Expression Systems
  • Baculovirus/Insect expression system
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • CXCR1
  • Full Name
  • C-X-C motif chemokine receptor 1
  • Introduction
  • The protein encoded by this gene is a member of the G-protein-coupled receptor family. This protein is a receptor for interleukin 8 (IL8). It binds to IL8 with high affinity, and transduces the signal through a G-protein activated second messenger system. Knockout studies in mice suggested that this protein inhibits embryonic oligodendrocyte precursor migration in developing spinal cord. This gene, IL8RB, a gene encoding another high affinity IL8 receptor, as well as IL8RBP, a pseudogene of IL8RB, form a gene cluster in a region mapped to chromosome 2q33-q36.
  • Alternative Names
  • C-C; CD128; CD181; CKR-1; IL8R1; IL8RA; CMKAR1; IL8RBA; CDw128a; C-C-CKR-1; C-X-C chemokine receptor type 1; CXC-R1; CXCR-1; IL-8 receptor type 1; IL-8R A; chemokine (C-X-C motif) receptor 1; high affinity interleukin-8 receptor A; interleukin 8 receptor, alpha; interleukin-8 receptor type 1; interleukin-8 receptor type A; CXCR1; C-X-C motif chemokine receptor 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us