Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CXCR4 (C-X-C motif chemokine receptor 4) Full Length (CAT#: MPC0074K) Made to Order

This product is a 39.7 kDa Human CXCR4 membrane protein expressed in Baculovirus/Insect expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CXCR4
  • Protein Length
  • Full length
  • Protein Class
  • GPCR
  • Molecular Weight
  • 39.7 kDa
  • TMD
  • 7
  • Sequence
  • MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFL
    TGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVA
    NWYFGNFLCKAVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKL
    LAEKVVYVGVWIPALLLTIPDFIFANVSEADDRYICDRFYPNDLWVVVFQ
    FQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKTTVILILAFFA
    CWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPI
    LYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFH
    SS

Product Description

  • Expression Systems
  • Baculovirus/Insect expression system
  • Tag
  • Flag tag at N-terminal and 10xHis tag at C-terminal
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • CXCR4
  • Full Name
  • C-X-C motif chemokine receptor 4
  • Introduction
  • This gene encodes a CXC chemokine receptor specific for stromal cell-derived factor-1. The protein has 7 transmembrane regions and is located on the cell surface. It acts with the CD4 protein to support HIV entry into cells and is also highly expressed in breast cancer cells. Mutations in this gene have been associated with WHIM (warts, hypogammaglobulinemia, infections, and myelokathexis) syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
  • Alternative Names
  • FB22; HM89; LAP3; LCR1; NPYR; WHIM; CD184; LAP-3; LESTR; NPY3R; NPYRL; WHIMS; HSY3RR; NPYY3R; D2S201E; C-X-C chemokine receptor type 4; CD184 antigen; LPS-associated protein 3
    SDF-1 receptor; chemokine (C-X-C motif) receptor 4; fusin; leukocyte-derived seven transmembrane domain receptor; lipopolysaccharide-associated protein 3; neuropeptide Y receptor Y3
    neuropeptide Y3 receptor; seven transmembrane helix receptor; seven-transmembrane-segment receptor, spleen; stromal cell-derived factor 1 receptor; CXCR4; C-X-C motif chemokine receptor 4

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us