Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human DEFB103A (Defensin beta 103A) for Antibody Discovery (CAT#: MP1248J)

This product is a 5.1 kDa Human DEFB103A membrane protein expressed in E. coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • DEFB103A
  • Protein Length
  • Partial
  • Protein Class
  • Transmembrane
  • Molecular Weight
  • 5.1 kDa
  • Sequence
  • GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK

Product Description

  • Expression Systems
  • E. coli
  • Tag
  • Tag Free
  • Endotoxin
  • < 1 EU/µg
  • Purity
  • >95% as determined by SDS-PAGE and Coomassie blue staining
  • Buffer
  • 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2

Target

  • Target Protein
  • DEFB103A
  • Full Name
  • Defensin beta 103A
  • Introduction
  • Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 103, an antibiotic peptide which is induced by bacteria and interferon gamma, and which displays antimicrobial activity against S. aureus, S. pyogenes, P. aeruginosa, E. coli, and C. albicans.
  • Alternative Names
  • BD-3; DEFB-3; DEFB103; DEFB3; hBD-3; HBD3; HBP-3; HBP3; beta-defensin 103; beta-defensin 3; defensin, beta 103

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us