Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human DGCR2 (DiGeorge syndrome critical region gene 2) Expressed in CHO for Antibody Discovery, Partial (22-349aa) (CAT#: MPX0771K)

This product is a 38 kDa Human DGCR2 membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • DGCR2
  • Protein Length
  • Partial (22-349aa)
  • Protein Class
  • Cell adhesion
  • Molecular Weight
  • 38 kDa
  • TMD
  • 1
  • Sequence
  • EPLRPELRCNPGQFACRSGTIQCIPLPWQ
    CDGWATCEDESDEANCPEVTGEVRPHHGKEAVDPRQGRARGGDPSHFHAV
    NVAQPVRFSSFLGKCPTGWHHYEGTASCYRVYLSGENYWDAAQTCQRLNG
    SLATFSTDQELRFVLAQEWDQPERSFGWKDQRKLWVGYQYVITGRNRSLE
    GRWEVAFKGSSEVFLPPDPIFASAMSENDNVFCAQLQCFHFPTLRHHDLH
    SWHAESCYEKSSFLCKRSQTCVDIKDNVVDEGFYFTPKGDDPCLSCTCHG
    GEPEMCVAALCERPQGCQQYRKDPKECCKFMCLDPDGNSLFDSMASGMR

Product Description

  • Activity
  • Yes
  • Expression Systems
  • CHO
  • Tag
  • 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 500 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • DGCR2
  • Full Name
  • DiGeorge syndrome critical region gene 2
  • Introduction
  • Deletions of the 22q11.2 have been associated with a wide range of developmental defects (notably DiGeorge syndrome, velocardiofacial syndrome, conotruncal anomaly face syndrome and isolated conotruncal cardiac defects) classified under the acronym CATCH 22. The DGCR2 gene encodes a novel putative adhesion receptor protein, which could play a role in neural crest cells migration, a process which has been proposed to be altered in DiGeorge syndrome. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • DGCR2; IDD; LAN; DGS-C; SEZ-12; integral membrane protein DGCR2/IDD; DiGeorge syndrome critical region protein 2; integral membrane protein deleted in DiGeorge syndrome; DiGeorge syndrome critical region gene 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us