Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human DNAJB9 (DnaJ heat shock protein family (Hsp40) member B9) for Antibody Discovery (CAT#: MP1314J)

This product is a 25.5 kDa Human DNAJB9 membrane protein expressed in E. coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • DNAJB9
  • Protein Length
  • Full-length
  • Protein Class
  • Druggable Genome, Transmembrane
  • Molecular Weight
  • 25.5 kDa
  • Sequence
  • MATPQSIFIFAICILMITELILASKSYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKS
    PDAEAKFREIAEAYETLSDANRRKEYDTLGHSAFTSGKGQRGSGSSFEQSFNFNFDDLFK
    DFGFFGQNQNTGSKKRFENHFQTRQDGGSSRQRHHFQEFSFGGGLFDDMFEDMEKMFSFS
    GFDSTNQHTVQTENRFHGSSKHCRTVTQRRGNMVTTYTDCSGQ

Product Description

  • Expression Systems
  • E. coli
  • Tag
  • N-His
  • Endotoxin
  • < 1 EU/µg
  • Purity
  • > 80% as determined by SDS-PAGE and Coomassie blue staining
  • Buffer
  • 25mM Tris, pH8.0, 150 mM NaCl, 10% glycerol, 1 % Sarkosyl

Target

  • Target Protein
  • DNAJB9
  • Full Name
  • DnaJ heat shock protein family (Hsp40) member B9
  • Introduction
  • This gene is a member of the J protein family. J proteins function in many cellular processes by regulating the ATPase activity of 70 kDa heat shock proteins. This gene is a member of the type 2 subgroup of DnaJ proteins. The encoded protein is localized to the endoplasmic reticulum. This protein is induced by endoplasmic reticulum stress and plays a role in protecting stressed cells from apoptosis.
  • Alternative Names
  • ERdj4; MDG-1; MDG1; MST049; MSTP049; DnaJ (Hsp40) homolog, subfamily B, member 9; ER-resident protein ERdj4; endoplasmic reticulum DNA J domain-containing protein 4; microvascular endothelial differentiation gene 1 protein

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us