Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human STEAP1 (STEAP family member 1) Expressed in E.coli with GST tag at the N-terminus for Antibody Discovery, Partial (3-69aa) (CAT#: MPX4437K)

This product is a 35.0kDa Human STEAP1 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • STEAP1
  • Protein Length
  • Partial (3-69aa)
  • Protein Class
  • Transporter
  • Molecular Weight
  • 35.0kDa
  • TMD
  • 6
  • Sequence
  • SRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFP

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • GST tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • STEAP1
  • Full Name
  • STEAP family member 1
  • Introduction
  • This gene is predominantly expressed in prostate tissue, and is found to be upregulated in multiple cancer cell lines. The gene product is predicted to be a six-transmembrane protein, and was shown to be a cell surface antigen significantly expressed at cell-cell junctions.
  • Alternative Names
  • STEAP; PRSS24; metalloreductase STEAP1; STEAP1 metalloreductase; six transmembrane epithelial antigen of the prostate 1; six-transmembrane epithelial antigen of prostate 1; STEAP1; STEAP family member 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us