Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human EDA2R (Ectodysplasin A2 receptor) Expressed in NS0 for Antibody Discovery, Partial (1-136aa) (CAT#: MPX0420K)

This product is a 41.8 kDa Human EDA2R membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • EDA2R
  • Protein Length
  • Partial (1-136aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 41.8 kDa
  • TMD
  • 1
  • Sequence
  • MDCQENEYWDQWGRCVTCQRCGPGQELSKDCGYGEGGDAYCTACPPRRYK
    SSWGHHRCQSCITCAVINRVQKVNCTATSNAVCGDCLPRFYRKTRIGGLQ
    DQECIPCTKQTPTSEVQCAFQLSLVEADTPTVPPQE

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • EDA2R
  • Full Name
  • Ectodysplasin A2 receptor
  • Introduction
  • The protein encoded by this gene is a type III transmembrane protein of the TNFR (tumor necrosis factor receptor) superfamily, and contains cysteine-rich repeats and a single transmembrane domain. This protein binds to the EDA-A2 isoform of ectodysplasin, which plays an important role in maintenance of hair and teeth. Alternatively spliced transcript variants encodes distinct protein isoforms.
  • Alternative Names
  • EDA2R; XEDAR; EDAA2R; EDA-A2R; TNFRSF27; tumor necrosis factor receptor superfamily member 27; EDA-A2 receptor; X-linked ectodysplasin-A2 receptor; tumor necrosis factor receptor superfamily member XEDAR; Ectodysplasin A2 receptor

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us