Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human EDNRA (Endothelin receptor type A) Expressed in Yeast with 6xHis tag at the N-terminus for Antibody Discovery, Partial (21-80aa) (CAT#: MPX4517K)

This product is a 8.8kDa Human EDNRA membrane protein expressed in Yeast. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • EDNRA
  • Protein Length
  • Partial (21-80aa)
  • Protein Class
  • GPCR
  • Molecular Weight
  • 8.8kDa
  • TMD
  • 7
  • Sequence
  • DNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFK

Product Description

  • Expression Systems
  • Yeast
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • EDNRA
  • Full Name
  • Endothelin receptor type A
  • Introduction
  • This gene encodes the receptor for endothelin-1, a peptide that plays a role in potent and long-lasting vasoconstriction. This receptor associates with guanine-nucleotide-binding (G) proteins, and this coupling activates a phosphatidylinositol-calcium second messenger system. Polymorphisms in this gene have been linked to migraine headache resistance. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • ETA; ET-A; ETAR; ETRA; MFDA; ETA-R; hET-AR; endothelin-1 receptor; G protein-coupled receptor; endothelin receptor subtype A; endothelin-1-specific receptor; EDNRA; Endothelin receptor type A

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us