Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human EPCAM (Epithelial cell adhesion molecule) with GST-tag for Antibody Discovery (CAT#: MP0331X)

This product is a 60.17 kDa Human EPCAM membrane protein expressed in in vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • EPCAM
  • Protein Length
  • Full-length
  • Molecular Weight
  • 60.17 kDa
  • TMD
  • 1
  • Sequence
  • MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • in vitro wheat germ expression system
  • Tag
  • GST-tag at N-terminal
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer

Target

  • Target Protein
  • EPCAM
  • Full Name
  • Epithelial cell adhesion molecule
  • Introduction
  • This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy
  • Alternative Names
  • 17-1A; 323/A3; CD326; CO-17A; CO17-1A; EGP; EGP-2; EGP34; EGP40; ESA; Ep-CAM; GA733-2; HEA125; KS1/4; KSA; M4S1; MH99; MIC18; MK-1; MOC31; TACST-1; TACSTD1; TROP1; hEGP-2; adenocarcinoma-associated antigen; carcinoma-associated antigen GA733-2; human epithelial glycoprotein-2; membrane component; chromosome 4, surface marker (35kD glycoprotein); tumor-associated calcium signal transducer 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us