Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human FCAR (Fc fragment of IgA receptor) Full Length (CAT#: MPC2559K) Made to Order

This product is a made-to-order Human FCAR membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FCAR
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • TMD
  • 1
  • Sequence
  • MDPKQTTLLCLVLCLGQRIQAQEGDFPMPFISAKSSPVIPLDGSVKIQCQ
    AIREAYLTQLMIIKNSTYREIGRRLKFWNETDPEFVIDHMDANKAGRYQC
    QYRIGHYRFRYSDTLELVVTGLYGKPFLSADRGLVLMPGENISLTCSSAH
    IPFDRFSLAKEGELSLPQHQSGEHPANFSLGPVDLNVSGIYRCYGWYNRS
    PYLWSFPSNALELVVTDSIHQDYTTQNLIRMAVAGLVLVALLAILVENWH
    SHTALNKEASADVAEPSWSQQMCQPGLTFARTPSVCK

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • FCAR
  • Full Name
  • Fc fragment of IgA receptor
  • Introduction
  • This gene is a member of the immunoglobulin gene superfamily and encodes a receptor for the Fc region of IgA. The receptor is a transmembrane glycoprotein present on the surface of myeloid lineage cells such as neutrophils, monocytes, macrophages, and eosinophils, where it mediates immunologic responses to pathogens. It interacts with IgA-opsonized targets and triggers several immunologic defense processes, including phagocytosis, antibody-dependent cell-mediated cytotoxicity, and stimulation of the release of inflammatory mediators. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene.
  • Alternative Names
  • FCAR; CD89; FcalphaRI; CTB-61M7.2; immunoglobulin alpha Fc receptor; FCAR variant 14; Fc alpha receptor; Fc fragment of IgA, receptor for; Fc fragment of IgA receptor

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us