Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human FCMR (Fc fragment of IgM receptor) Expressed in HEK293 for Antibody Discovery, Partial (18-251aa) (CAT#: MPX0812K)

This product is a 27 kDa Human FCMR membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FCMR
  • Protein Length
  • Partial (18-251aa)
  • Protein Class
  • Immunity
  • Molecular Weight
  • 27 kDa
  • TMD
  • 1
  • Sequence
  • RILPEVKVEGELGGSVTIKCPLPEMHVRIYLCR
    EMAGSGTCGTVVSTTNFIKAEYKGRVTLKQYPRKNLFLVEVTQLTESDSG
    VYACGAGMNTDRGKTQKVTLNVHSEYEPSWEEQPMPETPKWFHLPYLFQM
    PAYASSSKFVTRVTTPAQRGKVPPVHHSSPTTQITHRPRVSRASSVAGDK
    PRTFLPSTTASKISALEGLLKPQTPSYNHHTRLHRQRALDYGSQSGREGQ
    G

Product Description

  • Activity
  • Yes
  • Expression Systems
  • HEK293
  • Tag
  • HA tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 200 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose.

Target

  • Target Protein
  • FCMR
  • Full Name
  • Fc fragment of IgM receptor
  • Introduction
  • Fc receptors specifically bind to the Fc region of immunoglobulins (Igs) to mediate the unique functions of each Ig class. FAIM3 encodes an Fc receptor for IgM.
  • Alternative Names
  • FCMR; TOSO; FAIM3; fas apoptotic inhibitory molecule 3; Fc mu receptor; IgM Fc fragment receptor; IgM Fc receptor; immunoglobulin mu Fc receptor; regulator of Fas-induced apoptosis Toso; Fc fragment of IgM receptor

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us