Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human FCER2 (Fc fragment of IgE receptor II) Expressed in NS0 for Antibody Discovery, Partial (48-321aa) (CAT#: MPX0304K)

This product is a 32 kDa Human FCER2 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FCER2
  • Protein Length
  • Partial (48-321aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 32 kDa
  • TMD
  • 1
  • Sequence
  • DTT
    QSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQ
    RLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRM
    ELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVS
    IHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEP
    TSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESM
    GPDSRPDPDGRLPTPSAPLHS

Product Description

  • Expression Systems
  • NS0
  • Tag
  • 9xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >90%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • FCER2
  • Full Name
  • Fc fragment of IgE receptor II
  • Introduction
  • The protein encoded by this gene is a B-cell specific antigen, and a low-affinity receptor for IgE. It has essential roles in B cell growth and differentiation, and the regulation of IgE production. This protein also exists as a soluble secreted form, then functioning as a potent mitogenic growth factor. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
  • Alternative Names
  • FCER2; CD23; FCE2; CD23A; IGEBF; CLEC4J; BLAST-2; low affinity immunoglobulin epsilon Fc receptor; C-type lectin domain family 4, member J; CD23 antigen; Fc epsilon receptor II; Fc fragment of IgE, low affinity II, receptor for (CD23); fc-epsilon-RII; immunoglobulin E-binding factor; immunoglobulin epsilon-chain; lymphocyte IgE receptor; Fc fragment of IgE receptor II

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us