Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human FCGR2B (Fc fragment of IgG receptor IIb) Expressed in NS0 for Antibody Discovery, Partial (46-217aa) (CAT#: MPX0206K)

This product is a 21 kDa Human FCGR2B membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FCGR2B
  • Protein Length
  • Partial (46-217aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 21 kDa
  • TMD
  • 1
  • Sequence
  • APPKA
    VLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYR
    FKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVL
    RCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNI
    GYTLYSSKPVTITVQAP

Product Description

  • Expression Systems
  • NS0
  • Tag
  • 10xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <1.0 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • FCGR2B
  • Full Name
  • Fc fragment of IgG receptor IIb
  • Introduction
  • The protein encoded by this gene is a low affinity receptor for the Fc region of immunoglobulin gamma complexes. The encoded protein is involved in the phagocytosis of immune complexes and in the regulation of antibody production by B-cells. Variations in this gene may increase susceptibilty to systemic lupus erythematosus (SLE). Several transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • FCGR2B; CD32; FCG2; CD32B; FCGR2; IGFR2; FCGR2C; FcRII-c; low affinity immunoglobulin gamma Fc region receptor II-b; CDw32; Fc fragment of IgG, low affinity II, receptor for (CD32); Fc fragment of IgG, low affinity IIb, receptor (CD32); Fc fragment of IgG, low affinity IIb, receptor for (CD32); Fc gamma RIIb; Fc gamma receptor IIb; Fc-gamma RII-c; Fc-gamma-RIIc; IgG Fc receptor II-c; Low affinity immunoglobulin gamma Fc region receptor II-c; fc-gamma RII-b; fc-gamma-RIIb; fcRII-b; igG Fc receptor II-b; Fc fragment of IgG receptor IIb

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us