Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human FCRL4 (Fc receptor like 4) Expressed in CHO for Antibody Discovery, Partial (18-385aa) (CAT#: MPX0413K)

This product is a 42 kDa Human FCRL4 membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FCRL4
  • Protein Length
  • Partial (18-385aa)
  • Protein Class
  • Receptor; Immunity
  • Molecular Weight
  • 42 kDa
  • TMD
  • 1
  • Sequence
  • AAAHKPVISVHPPWTTFFKGERVTLTCNGFQFY
    ATEKTTWYHRHYWGEKLTLTPGNTLEVRESGLYRCQARGSPRSNPVRLLF
    SSDSLILQAPYSVFEGDTLVLRCHRRRKEKLTAVKYTWNGNILSISNKSW
    DLLIPQASSNNNGNYRCIGYGDENDVFRSNFKIIKIQELFPHPELKATDS
    QPTEGNSVNLSCETQLPPERSDTPLHFNFFRDGEVILSDWSTYPELQLPT
    VWRENSGSYWCGAETVRGNIHKHSPSLQIHVQRIPVSGVLLETQPSGGQA
    VEGEMLVLVCSVAEGTGDTTFSWHREDMQESLGRKTQRSLRAELELPAIR
    QSHAGGYYCTADNSYGPVQSMVLNVTVRETPGNRD

Product Description

  • Activity
  • Yes
  • Expression Systems
  • CHO
  • Tag
  • 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 250 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • FCRL4
  • Full Name
  • Fc receptor like 4
  • Introduction
  • This gene encodes a member of the immunoglobulin receptor superfamily and is one of several Fc receptor-like glycoproteins clustered on the long arm of chromosome 1. The encoded protein has four extracellular C2-type immunoglobulin domains, a transmembrane domain and a cytoplasmic domain that contains three immune-receptor tyrosine-based inhibitory motifs. This protein may play a role in the function of memory B-cells in the epithelia. Aberrations in the chromosomal region encoding this gene are associated with non-Hodgkin lymphoma and multiple myeloma.
  • Alternative Names
  • FCRL4; FCRH4; IGFP2; IRTA1; CD307d; Fc receptor-like protein 4; IFGP family protein 2; fc receptor homolog 4; fcR-like protein 4; hIFGP2; immune receptor translocation-associated protein 1; immunoglobulin superfamily Fc receptor, gp42; immunoglobulin superfamily receptor translocation associated 1; Fc receptor like 4

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us