Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human FPR1 (Formyl peptide receptor 1) for Antibody Discovery (CAT#: MP1350J)

This product is a 34.9 kDa Human FPR1 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FPR1
  • Protein Length
  • Partial (306-350aa)
  • Protein Class
  • GPCR
  • Molecular Weight
  • 34.9 kDa
  • Sequence
  • QDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • N-10xHis-SUMO and C-Myc
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Liquid: Tris/PBS-based buffer, 5%-50% glycerol
    Lyophilized powder: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • FPR1
  • Full Name
  • Formyl peptide receptor 1
  • Introduction
  • This gene encodes a G protein-coupled receptor of mammalian phagocytic cells that is a member of the G-protein coupled receptor 1 family. The protein mediates the response of phagocytic cells to invasion of the host by microorganisms and is important in host defense and inflammation.
  • Alternative Names
  • fMet Leu Phe receptor; fMet-Leu-Phe receptor; FMLP; fMLP receptor; FMLPR; Formyl peptide receptor 1; FPR 1; FPR; FPR receptor; FPR1; FPR1_HUMAN; N formyl peptide chemoattractant receptor; N formyl peptide receptor; N formylpeptide chemoattractant receptor; N-formyl peptide receptor; N-formylpeptide chemoattractant receptor

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us