Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
With over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications.
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
With deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
Get a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
This product is a 34.9 kDa Human FPR1 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.
Product Specifications
Host Species
Human
Target Protein
FPR1
Protein Length
Partial (306-350aa)
Protein Class
GPCR
Molecular Weight
34.9 kDa
Sequence
QDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK
Product Description
Expression Systems
E.coli
Tag
N-10xHis-SUMO and C-Myc
Reconstitution
Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
This gene encodes a G protein-coupled receptor of mammalian phagocytic cells that is a member of the G-protein coupled receptor 1 family. The protein mediates the response of phagocytic cells to invasion of the host by microorganisms and is important in host defense and inflammation.
Alternative Names
fMet Leu Phe receptor; fMet-Leu-Phe receptor; FMLP; fMLP receptor; FMLPR; Formyl peptide receptor 1; FPR 1; FPR; FPR receptor; FPR1; FPR1_HUMAN; N formyl peptide chemoattractant receptor; N formyl peptide receptor; N formylpeptide chemoattractant receptor; N-formyl peptide receptor; N-formylpeptide chemoattractant receptor