Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human FSHR (Follicle stimulating hormone receptor) Expressed in Mammalian cell expression system with hIgG1 FC tag at the C-terminus for Antibody Discovery, Partial (18-366aa) (CAT#: MPX4192K)

This product is a 68.8 kDa Human FSHR membrane protein expressed in Mammalian cell expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FSHR
  • Protein Length
  • Partial (18-366aa)
  • Protein Class
  • GPCR
  • Molecular Weight
  • 68.8 kDa
  • TMD
  • 7
  • Sequence
  • CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSILRQEVDYMTQARGQRSSLAEDNESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKPDAFNPCEDIMGYNILR

Product Description

  • Expression Systems
  • Mammalian cell expression system
  • Tag
  • hIgG1 FC tag at the C-terminus
  • Protein Format
  • Soluble
  • Purity
  • >85% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • FSHR
  • Full Name
  • Follicle stimulating hormone receptor
  • Introduction
  • The protein encoded by this gene belongs to family 1 of G-protein coupled receptors. It is the receptor for follicle stimulating hormone and functions in gonad development. Mutations in this gene cause ovarian dysgenesis type 1, and also ovarian hyperstimulation syndrome. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • LGR1; ODG1; FSHR1; FSHRO; follicle-stimulating hormone receptor; FSH receptor; follitropin receptor; FSHR; Follicle stimulating hormone receptor

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us