Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human FXYD2 (FXYD domain containing ion transport regulator 2) for Antibody Discovery (CAT#: MP0380X)

This product is a 32.78 kDa Human FXYD2 membrane protein expressed in in vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FXYD2
  • Protein Length
  • Full-length
  • Molecular Weight
  • 32.78 kDa
  • TMD
  • 1
  • Sequence
  • MDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • in vitro wheat germ expression system
  • Tag
  • GST-tag at N-terminal
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer

Target

  • Target Protein
  • FXYD2
  • Full Name
  • FXYD domain containing ion transport regulator 2
  • Introduction
  • This gene encodes a member of the FXYD family of transmembrane proteins. This particular protein encodes the sodium/potassium-transporting ATPase subunit gamma. Mutations in this gene have been associated with Renal Hypomagnesemia-2. Alternatively spliced transcript variants have been described. Read-through transcripts have been observed between this locus and the upstream FXYD domain-containing ion transport regulator 6 (FXYD6, GeneID 53826) locus
  • Alternative Names
  • ATP1G1; HOMG2; MGC12372; ATPase, Na+/K+ transporting, gamma 1 polypeptide; FXYD domain-containing ion transport regulator 2; Sodium-potassium-ATPase, gamma polypeptide, hypomagnesemia 2, renal

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us