Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human FXYD2 (FXYD domain containing ion transport regulator 2) expressed in E.coli for Antibody Discovery (CAT#: MP1382J)

This product is a 34.4 kDa Human FXYD2 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FXYD2
  • Protein Length
  • Partial (1-64aa)
  • Protein Class
  • Ion Channel
  • Molecular Weight
  • 34.4 kDa
  • Sequence
  • MDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • N-GST
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Liquid: Tris/PBS-based buffer, 5%-50% glycerol
    Lyophilized powder: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • FXYD2
  • Full Name
  • FXYD domain containing ion transport regulator 2
  • Introduction
  • This gene encodes a member of the FXYD family of transmembrane proteins. This particular protein encodes the sodium/potassium-transporting ATPase subunit gamma. Mutations in this gene have been associated with Renal Hypomagnesemia-2. Alternatively spliced transcript variants have been described. Read-through transcripts have been observed between this locus and the upstream FXYD domain-containing ion transport regulator 6 (FXYD6, GeneID 53826) locus.
  • Alternative Names
  • FXYD2; ATP1C; ATP1G1; Sodium/potassium-transporting ATPase subunit gamma; Na(+)/K(+) ATPase subunit gamma; FXYD domain-containing ion transport regulator 2; Sodium pump gamma chain

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us