Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human FXYD6 (FXYD domain containing ion transport regulator 6) for Antibody Discovery (CAT#: MP0841J)

This product is a 10.4 kDa Human FXYD6 membrane protein expressed in HEK293T. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FXYD6
  • Protein Length
  • Full-length
  • Protein Class
  • Ion Channels: Other, Transmembrane
  • Molecular Weight
  • 10.4 kDa
  • TMD
  • 1
  • Sequence
  • MELVLVFLCSLLAPMVLASAAEKEKEMDPFHYDYQTLRIGGLVFAVVLFSVGILLILSRRCKCSFNQKPR
    APGDEEAQVENLITANATEPQKAEN

Product Description

  • Expression Systems
  • HEK293T
  • Tag
  • C-Myc/DDK
  • Purification
  • Anti-DDK affinity column followed by conventional chromatography steps
  • Purity
  • > 80% as determined by SDS-PAGE and Coomassie blue staining
  • Buffer
  • 25mM Tris, pH8.0, 150 mM NaCl, 10% glycerol, 1 % Sarkosyl

Target

  • Target Protein
  • FXYD6
  • Full Name
  • FXYD domain containing ion transport regulator 6
  • Introduction
  • This gene encodes a member of the FXYD family of transmembrane proteins. This particular protein encodes phosphohippolin, which likely affects the activity of Na,K-ATPase. Multiple alternatively spliced transcript variants encoding the same protein have been described. Related pseudogenes have been identified on chromosomes 10 and X. Read-through transcripts have been observed between this locus and the downstream sodium/potassium-transporting ATPase subunit gamma (FXYD2, GeneID 486) locus.
  • Alternative Names
  • FXYD domain-containing ion transport regulator 6; FXYD domain containing ion transport regulator 6; phosphohippolin

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us