Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human FZD1 (Frizzled class receptor 1) Expressed in CHO for Antibody Discovery, Partial (73-253aa) (CAT#: MPX0024K)

This product is a 46.6 kDa Human FZD1 membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FZD1
  • Protein Length
  • Partial (73-253aa)
  • Protein Class
  • GPCR
  • Molecular Weight
  • 46.6 kDa
  • TMD
  • 7
  • Sequence
  • QAAGQGPGQGPGPGQQPPPPPQQQQSGQ
    QYNGERGISVPDHGYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEV
    HQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQALPPCRSLCERARQGCEA
    LMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTPSLLPEFWTSN
    PQH

Product Description

  • Expression Systems
  • CHO
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Endotoxin
  • <0.1 EU/μg by the LAL method
  • Purity
  • >95%, as determined by Coomassie stained SDS-PAGE.
  • Buffer
  • 0.22 µm filtered protein solution is in PBS, pH 7.2

Target

  • Target Protein
  • FZD1
  • Full Name
  • Frizzled class receptor 1
  • Introduction
  • Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD1 protein contains a signal peptide, a cysteine-rich domain in the N-terminal extracellular region, 7 transmembrane domains, and a C-terminal PDZ domain-binding motif. The FZD1 transcript is expressed in various tissues.
  • Alternative Names
  • frizzled-1; Wnt receptor; frizzled 1, seven transmembrane spanning receptor; frizzled family receptor 1; frizzled homolog 1; frizzled, Drosophila, homolog of, 1; fz-1; fzE1; hFz1; FZD1; Frizzled class receptor 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us