Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human GABRB1 (Gamma-aminobutyric acid type A receptor subunit beta1) Expressed in Wheat germ for Antibody Discovery, Partial (28-136aa) (CAT#: MPX0058K)

This product is a 38 kDa Human GABRB1 membrane protein expressed in Wheat germ. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • GABRB1
  • Protein Length
  • Partial (28-136aa)
  • Protein Class
  • Transporter; Ion channel
  • Molecular Weight
  • 38 kDa
  • TMD
  • 4
  • Sequence
  • TNEPSNMPYVKETVDRLLKGYDIRLRPDFGGPPVDVGMRIDVASIDMVSEVNMDYTLTMYFQQSWKDKRLSYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTV

Product Description

  • Expression Systems
  • Wheat germ
  • Protein Format
  • Soluble
  • Endotoxin
  • <0.1 EU/μg by the LAL method
  • Buffer
  • pH: 8.00, Constituents: 0.31% Glutathione, 0.79% Tris HCl

Target

  • Target Protein
  • GABRB1
  • Full Name
  • Gamma-aminobutyric acid type A receptor subunit beta1
  • Introduction
  • The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes GABA A receptor, beta 1 subunit. It is mapped to chromosome 4p12 in a cluster comprised of genes encoding alpha 4, alpha 2 and gamma 1 subunits of the GABA A receptor. Alteration of this gene is implicated in the pathogenetics of schizophrenia.
  • Alternative Names
  • DEE45; EIEE45; gamma-aminobutyric acid receptor subunit beta-1; gamma-aminobutyric acid (GABA) A receptor, beta 1; gamma-aminobutyric acid type A receptor beta1 subunit; GABRB1; Gamma-aminobutyric acid type A receptor subunit beta1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us