Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human KCNMB1 (Potassium calcium-activated channel subfamily M regulatory beta subunit 1) Full Length (CAT#: MPC0632K) Made to Order

This product is a 21.7 kDa Human KCNMB1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • KCNMB1
  • Protein Length
  • Full length
  • Protein Class
  • Transporter; Ion channel
  • Molecular Weight
  • 21.7 kDa
  • TMD
  • 2
  • Sequence
  • MVKKLVMAQKRGETRALCLGVTMVVCAVITYYILVTTVLPLYQKSVWTQE
    SKCHLIETNIRDQEELKGKKVPQYPCLWVNVSAAGRWAVLYHTEDTRDQN
    QQCSYIPGSVDNYQTARADVEKVRAKFQEQQVFYCFSAPRGNETSVLFQR
    LYGPQALLFSLFWPTFLLTGGLLIIAMVKSNQYLSILAAQK

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • KCNMB1
  • Full Name
  • Potassium calcium-activated channel subfamily M regulatory beta subunit 1
  • Introduction
  • MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit and the product of this gene, the modulatory beta subunit. Intracellular calcium regulates the physical association between the alpha and beta subunits.
  • Alternative Names
  • hbeta1; BKbeta1; SLO-BETA; hslo-beta; K(VCA)beta; slo-beta-1; k(VCA)beta-1; calcium-activated potassium channel subunit beta-1; BK channel beta subunit 1; BK channel subunit beta-1; MaxiK channel beta-subunit 1; big potassium channel beta subunit 1; calcium-activated potassium channel, subfamily M subunit beta-1; charybdotoxin receptor subunit beta-1; large; conductance Ca2+-activated K+ channel beta 1 subunit; maxi K channel subunit beta-1; potassium channel subfamily M regulatory beta subunit 1; potassium large conductance calcium-activated channel, subfamily M, beta member 1; KCNMB1; Potassium calcium-activated channel subfamily M regulatory beta subunit 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us