Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human GP6 (Glycoprotein VI platelet) Expressed in NS0 for Antibody Discovery, Partial (21-267aa) (CAT#: MPX0410K)

This product is a 27.7 kDa Human GP6 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • GP6
  • Protein Length
  • Partial (21-267aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 27.7 kDa
  • TMD
  • 1
  • Sequence
  • QSGPLPKPSLQALPSSLVPLEKPVTLRCQG
    PPGVDLYRLEKLSSSRYQDQAVLFIPAMKRSLAGRYRCSYQNGSLWSLPS
    DQLELVATGVFAKPSLSAQPGPAVSSGGDVTLQCQTRYGFDQFALYKEGD
    PAPYKNPERWYRASFPIITVTAAHSGTYRCYSFSSRDPYLWSAPSDPLEL
    VVTGTSVTPSRLPTEPPSPVAEFSEATAELTVSFTNEVFTTETSRSITAS
    PKESDSPAGPARQYYTK

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <1.0 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >90%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • GP6
  • Full Name
  • Glycoprotein VI platelet
  • Introduction
  • This gene encodes a platelet membrane glycoprotein of the immunoglobulin superfamily. The encoded protein is a receptor for collagen and plays a critical role in collagen-induced platelet aggregation and thrombus formation. The encoded protein forms a complex with the Fc receptor gamma-chain that initiates the platelet activation signaling cascade upon collagen binding. Mutations in this gene are a cause of platelet-type bleeding disorder-11 (BDPLT11). Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
  • Alternative Names
  • GP6; GPIV; GPVI; BDPLT11; platelet glycoprotein VI; glycoprotein 6; platelet collagen receptor; Glycoprotein VI platelet

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us