Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human GP9 (Glycoprotein IX platelet) Full Length (CAT#: MPC2849K) Made to Order

This product is a made-to-order Human GP9 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • GP9
  • Protein Length
  • Full length
  • Protein Class
  • Cell adhesion
  • TMD
  • 1
  • Sequence
  • MPAWGALFLLWATAEATKDCPSPCTCRALETMGLWVDCRGHGLTALPALP
    ARTRHLLLANNSLQSVPPGAFDHLPQLQTLDVTQNPWHCDCSLTYLRLWL
    EDRTPEALLQVRCASPSLAAHGPLGRLTGYQLGSCGWQLQASWVRPGVLW
    DVALVAVAALGLALLAGLLCATTEALD

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • GP9
  • Full Name
  • Glycoprotein IX platelet
  • Introduction
  • This gene encodes a small membrane glycoprotein found on the surface of human platelets. It forms a 1-to-1 noncovalent complex with glycoprotein Ib, a platelet surface membrane glycoprotein complex that functions as a receptor for von Willebrand factor. The complete receptor complex includes noncovalent association of the alpha and beta subunits with the protein encoded by this gene and platelet glycoprotein V. Defects in this gene are a cause of Bernard-Soulier syndrome, also known as giant platelet disease. These patients have unusually large platelets and have a clinical bleeding tendency.
  • Alternative Names
  • GP9; GPIX; CD42a; platelet glycoprotein IX; glycoprotein 9; Glycoprotein IX platelet

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us