Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human GPR157 (G protein-coupled receptor 157) Expressed in E.coli, Full Length (CAT#: MPX0002K)

This product is a 39.4 kDa Human GPR157 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • GPR157
  • Protein Length
  • Full length
  • Protein Class
  • GPCR
  • Molecular Weight
  • 39.4 kDa
  • TMD
  • 7
  • Sequence
  • MQPSPPPTELVPSERAVVLLSCALSALGSGLLVATHALWPDLRSRARRLLLFLSLADLLSAASYFYGVLQNFAGPSWDCVLQGALSTFANTSSFFWTVAIALYLYLSIVRAARGPRTDRLLWAFHVVSWGVPLVITVAAVALKKIGYDASDVSVGWCWIDLEAKDHVLWMLLTGKLWEMLAYVLLPLLYLLVRKHINRAHTALSEYRPILSQEHRLLRHSSMADKKLVLIPLIFIGLRVWSTVRFVLTLCGSPAVQTPVLVVLHGIGNTFQGGANCIMFVLCTRAVRTRLFSLCCCCCSSQPPTKSPAGTPKAPAPSKPGESQESQGTPGELPST

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 10xHis tag at the N-terminus
  • Endotoxin
  • <0.1 EU/μg by the LAL method
  • Purity
  • >85% as determined by SDS-PAGE.
  • Buffer
  • Tris-based buffer50% glycerol

Target

  • Target Protein
  • GPR157
  • Full Name
  • G protein-coupled receptor 157
  • Alternative Names
  • G-protein coupled receptor 157; probable G-protein coupled receptor 157; GPR157; G protein-coupled receptor 157

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us