Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human HLA-B (Major histocompatibility complex, class I, B) Full Length (CAT#: MPC1397K) Made to Order

This product is a 40.4 kDa Human HLA-B membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • HLA-B
  • Protein Length
  • Full length
  • Protein Class
  • Immunity
  • Molecular Weight
  • 40.4 kDa
  • TMD
  • 1
  • Sequence
  • MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPRFISVG
    YVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRE
    SLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHDQYAYDGKDYIAL
    NEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGECVEWLRRYLENGK
    DKLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQ
    DTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
    SSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGKGGSYSQAACS
    DSAQGSDVSLTA

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • HLA-B
  • Full Name
  • Major histocompatibility complex, class I, B
  • Introduction
  • HLA-B belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. Class I molecules play a central role in the immune system by presenting peptides derived from the endoplasmic reticulum lumen. They are expressed in nearly all cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon 1 encodes the leader peptide, exon 2 and 3 encode the alpha1 and alpha2 domains, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region and exons 6 and 7 encode the cytoplasmic tail. Polymorphisms within exon 2 and exon 3 are responsible for the peptide binding specificity of each class one molecule. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. Hundreds of HLA-B alleles have been described.
  • Alternative Names
  • HLA-B; AS; HLAB; B-4901; HLA class I antigen HLA-B; HLA class I histocompatibility antigen, B alpha chain; MHC HLA-B cell surface glycoprotein; MHC HLA-B transmembrane glycoprotein; MHC class 1 antigen; MHC class I antigen HLA-B alpha chain; MHC class I antigen HLA-B heavy chain; MHC class I antigen SHCHA; MHC class I molecule; leukocyte antigen class I-B; Major histocompatibility complex, class I, B

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us