Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human HLA-F (Major histocompatibility complex, class I, F) Full Length (CAT#: MPC3954K) Made to Order

This product is a made-to-order Human HLA-F membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • HLA-F
  • Protein Length
  • Full length
  • Protein Class
  • Immunity
  • TMD
  • 1
  • Sequence
  • MAPRSLLLLLSGALALTDTWAGSHSLRYFSTAVSRPGRGEPRYIAVEYVD
    DTQFLRFDSDAAIPRMEPREPWVEQEGPQYWEWTTGYAKANAQTDRVALR
    NLLRRYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNED
    LRSWTAADTVAQITQRFYEAEEYAEEFRTYLEGECLELLRRYLENGKETL
    QRADPPKAHVAHHPISDHEATLRCWALGFYPAEITLTWQRDGEEQTQDTE
    LVETRPAGDGTFQKWAAVVVPPGEEQRYTCHVQHEGLPQPLILRWEQSPQ
    PTIPIVGIVAGLVVLGAVVTGAVVAAVMWRKKSSDRNRGSYSQAAV

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • HLA-F
  • Full Name
  • Major histocompatibility complex, class I, F
  • Introduction
  • This gene belongs to the HLA class I heavy chain paralogues. It encodes a non-classical heavy chain that forms a heterodimer with a beta-2 microglobulin light chain, with the heavy chain anchored in the membrane. Unlike most other HLA heavy chains, this molecule is localized in the endoplasmic reticulum and Golgi apparatus, with a small amount present at the cell surface in some cell types. It contains a divergent peptide-binding groove, and is thought to bind a restricted subset of peptides for immune presentation. This gene exhibits few polymorphisms. Multiple transcript variants encoding different isoforms have been found for this gene. These variants lack a coding exon found in transcripts from other HLA paralogues due to an altered splice acceptor site, resulting in a shorter cytoplasmic domain.
  • Alternative Names
  • HLA-F; HLAF; CDA12; HLA-5.4; HLA-CDA12; HLA class I histocompatibility antigen, alpha chain F; HLA F antigen; MHC class I antigen F; leukocyte antigen F; Major histocompatibility complex, class I, F

Case Studies

Customer reviews and Q&As    

Related Products
  • CAT
  • Product Name
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us