Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human IGSF11 (Immunoglobulin superfamily member 11) Expressed in CHO for Antibody Discovery, Partial (144-241aa) (CAT#: MPX0660K)

This product is a 37 kDa Human IGSF11 membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • IGSF11
  • Protein Length
  • Partial (144-241aa)
  • Protein Class
  • Cell adhesion
  • Molecular Weight
  • 37 kDa
  • TMD
  • 1
  • Sequence
  • PSAPHCQ
    IQGSQDIGSDVILLCSSEEGIPRPTYLWEKLDNTLKLPPTATQDQVQGTV
    TIRNISALSSGLYQCVASNAIGTSTCLLDLQVISPQPRNIG

Product Description

  • Activity
  • Yes
  • Expression Systems
  • CHO
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 200 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • IGSF11
  • Full Name
  • Immunoglobulin superfamily member 11
  • Introduction
  • IGSF11 is an immunoglobulin (Ig) superfamily member that is preferentially expressed in brain and testis. It shares significant homology with coxsackievirus and adenovirus receptor (CXADR; MIM 602621) and endothelial cell-selective adhesion molecule (ESAM).
  • Alternative Names
  • IGSF11; CT119; VSIG3; Igsf13; BT-IgSF; CXADRL1; CXADR like 1; V-set and immunoglobulin domain containing 3; V-set and immunoglobulin domain-containing protein 3; brain and testis-specific immunoglobin superfamily protein; brain and testis-specific immunoglobulin superfamily protein; cancer/testis antigen 119; Immunoglobulin superfamily member 11

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us