Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human EPGN (Epithelial mitogen) Full Length (CAT#: MPC3658K) Made to Order

This product is a made-to-order Human EPGN membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • EPGN
  • Protein Length
  • Full length
  • Protein Class
  • Growth factor
  • TMD
  • 1
  • Sequence
  • MALGVPISVYLLFNAMTALTEEAAVTVTPPITAQQGNWTVNKTEADNIEG
    PIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTL
    TSYAVDSYEKYIAIGIGVGLLLSGFLVIFYCYIRKRCLKLKSPYNVCSGE
    RRPL

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • EPGN
  • Full Name
  • Epithelial mitogen
  • Introduction
  • The protein encoded by this gene is a member of the epidermal growth factor family. Members of this family are ligands for the epidermal growth factor receptor and play a role in cell survival, proliferation and migration. This protein has been reported to have high mitogenic activity but low affinity for its receptor. Expression of this transcript and protein have been reported in cancer specimens of the breast, bladder, and prostate. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • EPGN; EPG; PRO9904; ALGV3072; epigen; epithelial mitogen homolog; Epithelial mitogen

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us