Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human IL12RB1 (Interleukin 12 receptor subunit beta 1) Expressed in CHO for Antibody Discovery, Partial (24-540aa) (CAT#: MPX0258K)

This product is a 85 kDa Human IL12RB1 membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • IL12RB1
  • Protein Length
  • Partial (24-540aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 85 kDa
  • TMD
  • 1
  • Sequence
  • CRTSECCFQDPPYPDADSGSASGPRDL
    RCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFS
    DQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSK
    LAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPL
    EMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQ
    DGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRT
    LHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTEPVALNISVG
    TNGTTMYWPARAQSMTYCIEWQPVGQDGGLATCSLTAPQDPDPAGMATYS
    WSRESGAMGQEKCYYITIFASAHPEKLTLWSTVLSTYHFGGNASAAGTPH
    HVSVKNHSLDSVSVDWAPSLLSTCPGVLKEYVVRCRDEDSKQVSEHPVQP
    TETQVTLSGLRAGVAYTVQVRADTAWLRGVWSQPQRFSIE

Product Description

  • Expression Systems
  • CHO
  • Tag
  • hIgG1 Fc and Avi tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 200 μg/mL in PBS.
  • Endotoxin
  • <1.0 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >90%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose.

Target

  • Target Protein
  • IL12RB1
  • Full Name
  • Interleukin 12 receptor subunit beta 1
  • Introduction
  • The protein encoded by this gene is a type I transmembrane protein that belongs to the hemopoietin receptor superfamily. This protein binds to interleukine 12 (IL12) with a low affinity, and is thought to be a part of IL12 receptor complex. This protein forms a disulfide-linked oligomer, which is required for its IL12 binding activity. The coexpression of this and IL12RB2 proteins was shown to lead to the formation of high-affinity IL12 binding sites and reconstitution of IL12 dependent signaling. Mutations in this gene impair the development of interleukin-17-producing T lymphocytes and result in increased susceptibility to mycobacterial and Salmonella infections. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • IL12RB1; CD212; IMD30; IL12RB; IL-12R-BETA1; interleukin-12 receptor subunit beta-1; IL-12 receptor beta component; IL-12 receptor subunit beta-1; IL-12R subunit beta-1; cluster of differentiation 212; interleukin 12 receptor, beta 1; interleukin-12 receptor beta-1 chain; Interleukin 12 receptor subunit beta 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us