Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human KCND1 (Potassium voltage-gated channel subfamily D member 1) expressed in Yeast for Antibody Discovery (CAT#: MP1371J)

This product is a 27.7 kDa Human KCND1 membrane protein expressed in Yeast. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • KCND1
  • Protein Length
  • Partial (410-647aa)
  • Protein Class
  • Ion Channel
  • Molecular Weight
  • 27.7 kDa
  • Sequence
  • NFSRIYHQNQRADKRRAQQKVRLARIRLAKSGTTNAFLQYKQNGGLEDSGSGEEQALCVRNRSAFEQQHHHLLHCLEKTTCHEFTDELTFSEALGAVSPGGRTSRSTSVSSQPVGPGSLLSSCCPRRAKRRAIRLANSTASVSRGSMQELDMLAGLRRSHAPQSRSSLNAKPHDSLDLNCDSRDFVAAIISIPTPPANTPDESQPSSPGGGGRAGSTLRNSSLGTPCLFPETVKISSL

Product Description

  • Expression Systems
  • Yeast
  • Tag
  • N-6xHis
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Liquid: Tris/PBS-based buffer, 5%-50% glycerol
    Lyophilized powder: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • KCND1
  • Full Name
  • Potassium voltage-gated channel subfamily D member 1
  • Introduction
  • This gene encodes a multipass membrane protein that comprises the pore subunit of the voltage-gated A-type potassium channel, which functions in the repolarization of membrane action potentials. Activity of voltage-gated potassium channels is important in a number of physiological processes, among them the regulation of neurotransmitter release, heart rate, insulin secretion, and smooth muscle contraction.
  • Alternative Names
  • Kcnd1; KCND1_HUMAN; Kv4.1; mShal; OTTHUMP00000025805; OTTHUMP00000025806; Potassium voltage gated channel Shal related subfamily member 1; Potassium voltage gated channel subfamily D member 1; Potassium voltage-gated channel subfamily D member 1; Shal type potassium channel; Voltage gated potassium channel Kv4.1; Voltage gated potassium channel subunit Kv4.1; Voltage-gated potassium channel subunit Kv4.1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us